CAMPSQ1618
Title : Beta-defensin 19
GenInfo Identifier : 71152320
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q8K3I8
Activity : Antibacterial
Validated : Predicted
Pfam : PF14862 : Defensin_big ( Big defensin )
InterPro : IPR025933 : Beta_defensin.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0001530 Molecular function Lipopolysaccharide binding ISO
GO:0061760 Biological process Antifungal innate immune response ISO
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0045087 Biological process Innate immune response ISO
Length : 64
Sequence:
GKNPILQCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHW
PRIP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India