CAMPSQ1606
Title : Beta-defensin 126
GenInfo Identifier : 23813954
Source : Macaca fascicularis [Crab-eating macaque]
Taxonomy : Animalia, Mammals
UniProt: Q9BEE3
Activity : Antibacterial
Validated : Predicted
InterPro : IPR025933 : Beta_defensin.
IPR020329 : Beta_defensin_126.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region NAS
GO:0030414 Molecular function Peptidase inhibitor activity NAS
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0006508 Biological process Proteolysis NAS
GO:0007338 Biological process Single fertilization IEA
Length : 43
Sequence:
NLYVKRCLNDIGICKKTCKPEEVRSEHGWVMCGKRKACCVPAD

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India