CAMPSQ1605
Title : 4 kDa defensin
GenInfo Identifier : 1169262
Source : Leiurus quinquestriatus hebraeus [Yellow scorpion]
Taxonomy : Animalia, Arachnida
UniProt: P41965
Activity : Antibacterial
Gram Nature : Gram+ve
Validated : Predicted
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 38
Sequence:
GFGCPLNQGACHRHCRSIRRRGGYCAGFFKQTCTCYRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India