CAMPSQ1592
Title : Putative antifungal protein
GenInfo Identifier : 75263249
Source : Arabidopsis thaliana [Mouse-ear cress]
Taxonomy : Plantae
UniProt: Q9FZ31
Activity : Antifungal
Validated : Predicted
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response ISS
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 50
Sequence:
LCKRESETWSGRCVNDYQCRDHCINNDRGNDGYCAGGYPWYRSCFCFFSC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India