CAMPSQ1531
Title : Myeloid cathelicidin 3
GenInfo Identifier : 75052275
Source : Equus caballus [Horse]
Taxonomy : Animalia, Mammals
UniProt: O62842
Activity : Antimicrobial
Validated : Predicted
InterPro : IPR001894 : Cathelicidin.
IPR018216 : Cathelicidin_CS.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0045087 Biological process Innate immune response IBA
GO:0005615 Cellular component Extracellular space IBA
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0045087 Biological process Innate immune response IBA
Length : 40
Sequence:
 KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India