CAMPSQ1474
Title : Milk lysozyme
GenInfo Identifier : 112030759
Source : Bos indicus x Bos taurus (hybrid cattle) [Hybrid cattle]
Taxonomy : Animalia, Mammals
UniProt: Q0MRP9
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00062 : Lys ( C-type lysozyme/alpha-lactalbumin family )
InterPro : IPR001916 : Glyco_hydro_22.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0003796 Molecular function Lysozyme activity IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0008152 Biological process Metabolic process IEA
Length : 45
Sequence:
MKALLILGLLLFSVAVQGKVFERCELARSLKRFGMDNFRGITLAN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India