CAMPSQ147
Title : Moricin-like peptide B
GenInfo Identifier : 146737992
Source : Galleria mellonella [Greater wax moth]
Taxonomy : Animalia, Insects
UniProt: A5JSU6
PubMed : 18207081
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( MIC = 100 microM), Micrococcus luteus ( MIC = 100 microM), Fusarium graminearum spores ( MIC = 10 microM), Fusarium oxysporum spores ( MIC = 100 microM), Leptosphaeria maculans spores ( MIC = 100 microM), Fusarium graminearum mycelia ( MIC = 280 microM), Fusarium oxysporum mycelia ( MIC = 280 microM)
Validated : Experimentally validated
Comment : No activity detected at concentration (>150 micromolar) against Aspergilus niger, Colletotrichum gloeosporioides
Pfam : PF06451 : Moricin ( Moricin )
InterPro : IPR009456 : Moricin_fam.
AMP Family : Moricin
Signature :
ID Type Pattern / HMM
MoricinH_16 HMM
MoricinP_16 Pattern A-[IL]-[KR]-x-[AGV]-G-x-[AIV]-[IV]-x(2)-[AG]-[FL]-x-[AGV]-[ILV]-[GNS]-[AI]-[AI]-[GS]-T-[AGT]-x-[DEQ]-[IV]-x-[ENST]-x-[FILV]-x-[NP]-[KR]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 43
Sequence:
GKIPVKAIKKGGQIIGKALRGINIASTAHDIISQFKPKKKKNH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India