CAMPSQ1435
Title : Cryptdin related sequence peptide
GenInfo Identifier : 41223174, 41223170, 41223162
Source : Mus musculus [Mouse]
Taxonomy : Animalia, Mammals
UniProt: Q70LV3, Q70LV5, Q70LV9
PubMed : 15235601
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR002366 : Defensin_propep.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0006955 Biological process Immune response IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0006955 Biological process Immune response IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0042802 Molecular function Identical protein binding IPI
GO:0001530 Molecular function Lipopolysaccharide binding IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0006955 Biological process Immune response IEA
GO:0032496 Biological process Response to lipopolysaccharide IDA
Length : 38
Sequence:
 LQDAAVGWGRRCPQCPRCPSCPSCPRCPRCPRCKCNPK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India