CAMPSQ1420
Title : Cecropin 3
GenInfo Identifier : 151574048
Source : Anopheles albimanus [New world malaria mosquito]
Taxonomy : Animalia, Insects
UniProt: A7L9C2
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00272 : Cecropin ( Cecropin family )
InterPro : IPR000875 : Cecropin.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0019731 Biological process Antibacterial humoral response IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 60
Sequence:
 MNFTKLFIMVAIAVLLIAGIQPVEAAPRMEIGKRREKLGRNVFKAAKKALPVIAGYKALG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India