CAMPSQ1405
Title : Enteric beta defensin
GenInfo Identifier : 31747507
Source : Bubalus bubalis [Domestic water buffalo]
Taxonomy : Animalia, Mammals
UniProt: Q7YS43
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR006080 : Defensin_beta/neutrophil.
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH_320 HMM
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 36
Sequence:
NPQSCHRNKGICVPIRCPGNMRQIGTCLGPPVKCCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India