CAMPSQ1395
Title : Antibacterial peptide chensirin-2
GenInfo Identifier : 93359276
Source : Rana chensinensis [Chinese brown frog]
Taxonomy : Animalia, Amphibia
UniProt: Q1KLZ4
Activity : Antimicrobial
Validated : Predicted
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0006955 Biological process Immune response IEA
Length : 59
Sequence:
 MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEERDVEVEKRIIPLPLGYFAKKT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India