CAMPSQ1380
Title : Beta defensin 4
GenInfo Identifier : 133778666
Source : Bos taurus [Bovine]
Taxonomy : Animalia, Mammals
UniProt: A4F2T2
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
Signature :
ID Type Pattern / HMM
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 32
Sequence:
NPQSCRWNMGVCIPISFLVNMRQIGTCFGPRV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India