CAMPSQ1378
Title : Beta defensin 2
GenInfo Identifier : 134802587
Source : Pongo pygmaeus [Bornean orangutan]
Taxonomy : Animalia, Mammals
UniProt: A4H1Z7
Activity : Antimicrobial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
IPR006080 : Defensin_beta/neutrophil.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019730 Biological process Antimicrobial humoral response IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 36
Sequence:
NPVTCLRSGAICHPGFCPRRYKHIGTCGLSVIKCCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India