CAMPSQ1310
Title : Beta-defensin 10
GenInfo Identifier : 48976029
Source : Gallus gallus [Chicken]
Taxonomy : Animalia, Aves
UniProt: Q6QLQ9
PubMed : 15148642
Activity : Antibacterial
Validated : Predicted
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0002227 Biological process Innate immune response in mucosa IBA
Length : 37
Sequence:
NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCRT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India