CAMPSQ1272
Title : Alpha-defensin 2
GenInfo Identifier : 75056440
Source : Macaca mulatta [Rhesus macaque]
Taxonomy : Animalia, Mammals
UniProt: Q9TTZ8
Activity : Antibacterial
Validated : Predicted
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
IPR006081 : Mammalian_defensins.
Signature :
ID Type Pattern / HMM
DefensinH32_11 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0019730 Biological process Antimicrobial humoral response IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 52
Sequence:
 MRTLAILAAILLFALLAQAKSLQETADDAATQEQPGEDDQDLAVSFEENGLS

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India