CAMPSQ1212
Title : Psychimicin
GenInfo Identifier : 25091023
Source : Oiketicus kirbyi [Bagworm moth]
Taxonomy : Animalia, Insects
UniProt: P83421
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
InterPro : IPR012525 : Antimicrobial_6.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 45
Sequence:
INNWVRVPPCDQVCSRTNPEKDECCRAHGHAFHATCSGGMQCYRR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India