CAMPSQ1184
Title : Lantibiotic Pep5
GenInfo Identifier : 125974
Source : Staphylococcus epidermidis
Taxonomy : Monera
UniProt: P19578
Activity : Antibacterial
Validated : Predicted
Pfam : PF08130 : Antimicrobial18 ( Type A lantibiotic family )
InterPro : IPR012519 : Lantibiotic_typ-A_Pep5.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005102 Molecular function Signaling receptor binding IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 34
Sequence:
TAGPAIRASVKQCQKTLKATRLFTVSCKGKNGCK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India