CAMPSQ1114
Title : Gallinacin-13
GenInfo Identifier : 82173547
Source : Gallus gallus [ Chicken]
Taxonomy : Animalia, Aves
UniProt: Q6IV18
PubMed : 15744537
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E.coli, L.monocytogenes, S.typhimurium, S.pyogenes
Validated : Experimentally validated
Comment : Inactive against S.aureus
Pfam : PF00711 : Defensin_beta ( Beta defensin )
InterPro : IPR001855 : Defensin_beta-typ.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH_320 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031731 Molecular function CCR6 chemokine receptor binding IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0002227 Biological process Innate immune response in mucosa IBA
Length : 66
Sequence:
FSDSQLCRNNHGHCRRLCFHMESWAGSCMNGRLRCCRFSTKQPFSNPKHSVLHTAEQDPS
PSLGGT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India