CAMPSQ1081
Title : Cathelicidin-B1
GenInfo Identifier : 82074983
Source : Gallus gallus [ Chicken]
Taxonomy : Animalia, Aves
UniProt: Q5F378
PubMed : 17827276
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
E. coli ( MIC = 2.5 microM ) , S. aureus ( MIC = 1.25 microM ) , P. aeruginosa ( MIC = 0.63 microM )
Validated : Experimentally validated
InterPro : IPR001894 : Cathelicidin.
AMP Family : Cathelicidin
Signature :
ID Type Pattern / HMM
CathelicidinH_140 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0099512 Cellular component Supramolecular fiber IMP
GO:0001530 Molecular function Lipopolysaccharide binding IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0050829 Biological process Defense response to Gram-negative bacterium IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IMP
GO:0045087 Biological process Innate immune response IBA
Length : 40
Sequence:
PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India