CAMPSQ1032
Title : Manduca Sexta Moricin
GenInfo Identifier : 170784960
Source : Manduca sexta [Tobacco hawkmoth]
Taxonomy : Animalia, Insects
UniProt: Q86MA1
PDB: 2JR8
Structure Database : CAMPST156
PubMed : 18265434
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
Pfam : PF06451 : Moricin ( Moricin )
InterPro : IPR009456 : Moricin_fam.
AMP Family : Moricin
Signature :
ID Type Pattern / HMM
MoricinH_16 HMM
MoricinP_16 Pattern A-[IL]-[KR]-x-[AGV]-G-x-[AIV]-[IV]-x(2)-[AG]-[FL]-x-[AGV]-[ILV]-[GNS]-[AI]-[AI]-[GS]-T-[AGT]-x-[DEQ]-[IV]-x-[ENST]-x-[FILV]-x-[NP]-[KR]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0045087 Biological process Innate immune response IEA
GO:0009617 Biological process Response to bacterium IEP
Length : 42
Sequence:
GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India