CAMPSQ820
Title : Enterocin EJ97
GenInfo Identifier : 21702214
Source : Enterococcus faecalis
Taxonomy : Bacteria
NCBI Taxonomy : 1351
UniProt: Q8KMU4
PubMed : Reference: Patel S, Stott I P, Bhakoo M, Elliott P (1988) Patenting computer-designed peptides. Journal of Computer-Aided Molecular Design, 12: 543556.
Length : 44
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Enterococci, Bacillus, Listeria, Staphylococcus aureus
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
MLAKIKAMIKKFPNPYTLAAKLTTYEINWYKQQYGRYPWERPVA