CAMPSQ819
Title : Enterocin Q
GenInfo Identifier : 110832851
Source : Enterococcus faecium
Taxonomy : Bacteria
NCBI Taxonomy : 1352
UniProt: Q7WYZ9
PubMed : Reference: Patel S, Stott I P, Bhakoo M, Elliott P (1988) Patenting computer-designed peptides. Journal of Computer-Aided Molecular Design, 12: 543556.
Length : 34
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Lactobacillus sakei 2714 , Enterococcus faecium P13
Validated : Experimentally Validated
Comment : Inactive against Lactobacillus sakei 148 , Enterococcus faecium T136 , Pediococcus acidilactici 347 , Pediococcus pentosaceus FBB61
AMP Family : Bacteriocin
Sequence:
MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC