CAMPSQ818
Title : Acidocin A
GenInfo Identifier : 529068
Source : Lactobacillus acidophilus
Taxonomy : Bacteria
NCBI Taxonomy : 1579
UniProt: Q48496
PubMed : 11254635
Length : 58
Activity : Antibacterial
Gram Nature : Gram+ve
Target : L. acidophilus , L. brevis , L. casei , L. fermentum , L. plantarum , Pediococcus pentosaceus , Pediococcus halophilus , Streptococcus bovis , Streptococcus lactis , Streptococcus thermophilus , Enterococcus faecalis , Propionibacterium sp , Listeria mono
Validated : Experimentally Validated
Comment : Inactive against Bacillus subtilis , Staphylococcus aureus , E. coli , Salmonella typhimurium
InterPro : IPR010133 : Bacteriocin_signal_seq.
AMP Family : Bacteriocin
Sequence:
KTYYGTNGVHCTKKSLWGKVRLKNVIPGTLCRKQSLPIKQDLKILLGWATGAFGKTFH