CAMPSQ816
Title : Bacteriocin T8
GenInfo Identifier : 488292376
Source : Enterococcus faecium T8
Taxonomy : Bacteria
UniProt: Q27HG2
PubMed : Reference: Yamada, S., Komori, T., Imaseki, H (1997) Plant Physiol; 115:314.
Length : 44
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Enterococcus faecalis MDK1 , Enterococcus faecalis MDK2 , Enterococcus faecalis MDK3 , Enterococcus faecalis MDK4 , Enterococcus faecalis MDK5 , Lactobacillus sakei LMG 13558 , Streptococcus thermophilus LMG 13566 , Enterococcus faecalis BFE 1071 , Propio
Validated : Experimentally Validated
Comment : Inactive against Lactobacillus acidophilus LMG 13550 , Lactobacillus bulgaricus LMG 13551 , Lactobacillus bulgaricus LMG 13552 , Lactobacillus casei LHS3 , Lactobacillus casei LMG 13553 , Lactobacillus curvatus DF38 , Lactobacillus fermentum LMG 13554 , L
Pfam : PF01721 : ( Class II bacteriocin )
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM T. Length
CAMPBacH35 HMM 35
Sequence:
ATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR