CAMPSQ813
Title : Carnocyclin A
GenInfo Identifier : 186898221
Source : Carnobacterium maltaromaticum
Taxonomy : Bacteria
NCBI Taxonomy : 2751
UniProt: B2MVM5
PDB: 2KJF
Structure Database : CAMPST179
PubMed : 15752569
Length : 60
Activity : Antibacterial
Gram Nature : Gram+ve
Target : C. maltaromaticum UAL26 , C. maltaromaticum LV17A , C. divergens LV13 , Brochothrix campestris ATCC 43754 , Brochothrix thermosphacta ATCC 11509 , Enterococcus faecalis ATCC 7080 , Enterococcus faecium ATCC 19434 , E. faecium BFE900 , Lactococcus lactis s
Validated : Experimentally Validated
Comment : Inactive against Escherichia coli JM109 , E. coli BF2 , E. coli DH5{alpha} , Pseudomonas aeruginosa ATCC 14207 , P. aeruginosa ATCC 15442 , Salmonella enterica serovar Typhimurium ATCC 23564 , S. enterica serovar Typhimurium ATCC 13311
Pfam : PF09221 : ( Bacteriocin class IId cyclical uberolysin-like )
InterPro : IPR020038 : Bacteriocin_uberolysin.
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0019835 Biological Process Cytolysis IEA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IDA
Sequence:
LVAYGIAQGTAEKVVSLINAGLTVGSIISILGGVTVGLSGVFTAVKAAIAKQGIKKAIQL