CAMPSQ795
Title : Closticin 574
GenInfo Identifier : 27261510
Source : Clostridium tyrobutyricum
Taxonomy : Bacteria
NCBI Taxonomy : 1519
UniProt: Q8GCU9
PubMed : Reference: Bull. Chem. Soc. Jpn., 58, 1469-1472 (1985)
Length : 82
Activity : Antibacterial
Gram Nature : Gram+ve
Target : C. beijerinckii ATCC 25752 , C. tyrobutyricum NIZO B570 , C. tyrobutyricum NIZO B575 , C. tyrobutyricum CNRZ500 , C. tyrobutyricum NIZO B590 , Lactobacillus alimentarius L4 , Lactobacillus buchneri L4 , Lactobacillus saké ATCC 15521
Validated : Experimentally Validated
Comment : Inactive against C. tyrobutyricum ADRIAT 932 , E. faecalis JH2-2 , E. faecalis OG1X , Lactobacillus brevis L40 , Lactobacillus casei subsp. casei L37 , Lactobacillus plantarum lacC , Lactobacillus saké IFO12456 , L. lactis IL1403 , L. lactis MG1363 , Ped
AMP Family : Bacteriocin
Sequence:
PNWTKIGKCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQKAAKLLVGATTWEEKLHAG
GYALINLAAELTGVAGIQANCF