CAMPSQ794
Title : Circularin A
GenInfo Identifier : 27261531
Source : Clostridium beijerinckii
Taxonomy : Bacteria
NCBI Taxonomy : 1520
UniProt: Q8GB47
PubMed : Reference: Bull. Chem. Soc. Jpn., 58, 1469-1472 (1985)
Length : 69
Activity : Antibacterial
Gram Nature : Gram+ve
Target : C. tyrobutyricum NIZO B570 , C. tyrobutyricum ADRIAT 932 , C. tyrobutyricum NIZO B575 , C. tyrobutyricum CNRZ500 , C. tyrobutyricum NIZO B590 , E. faecalis JH2-2 , E. faecalis OG1X , Lactobacillus alimentarius L4 , Lactobacillus saké ATCC 15521 , Lactobac
Validated : Experimentally Validated
Comment : Inactive against C. beijerinckii ATCC 25752 , Lactobacillus brevis L40 , Lactobacillus buchneri L4 , Lactobacillus casei subsp. casei L37 , Lactobacillus plantarum lacC , Pediococcus pentosaceus FBB61-2 , Pediococcus pentosaceus PPE 1.2
Pfam : PF09221 : ( Bacteriocin class IId cyclical uberolysin-like )
InterPro : IPR009086 : Bacteriocin_AS48.
IPR020038 : Bacteriocin_uberolysin.
AMP Family : Bacteriocin
Sequence:
VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWATFKATVQKLAK
QSMARAIAY