CAMPSQ4985
Title : Bacteriocin weissellin-A
GenInfo Identifier : 363805607
Source : Weissella paramesenteroides
Taxonomy : Bacteria
UniProt: B3A0N4
PubMed : 21511463
Length : 43
Activity : Antibacterial
Gram Nature : Gram +ve
Target : M.flavus strain ATCC 400, M.luteus strain CECT241, C.soprogenes strain NCTC533, L.monocytogenes strain ATCC 19111, L.inocua strain ATCC BAA-680D, S.carnosus strain LMG13564, B.cereus strain LMG13569, C.thiaminolyticum strain ATCC 15579, E.faecalis strain
Validated : Experimentally Validated
Comment : Inactive against S.enteritidis ATCC 13076
Pfam : PF01721 : ( Class II bacteriocin )
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM T. Length
CAMPBacH35 HMM 35
Sequence:
KNYGNGVYCNKHKCSVDWATFSANIANNSVAMAGLTGGNAGNK