CAMPSQ4324
Title : Sakacin A
Source : Lactobacillus sake Lb 706
Taxonomy : Bacteria
PubMed : 8633865
Length : 41
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Lactobacillus sake NCDO 2714, Listeria innocua , Lactobacillus plantarum 965, Listeria monocytogenes, Enterococcus faecium, Enterococcus faeclis
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
ARSYGNGVYCNNKKCWVNRGEATQSIIGGMISGWASGKAGM