CAMPSQ3851
Title : Subtilosin A1
GenInfo Identifier : 27734551
Source : Bacillus subtilis
Taxonomy : Bacteria
NCBI Taxonomy : 224308
UniProt: O07623
PDB: 1PXQ
Structure Database : CAMPST60
PubMed : 19633086
Length : 35
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Bacillus subtilis ( MIC = 100 microM ), Bacillus anthracis ( MIC = 2.56 microM ), Bacillus cereus ( MIC = 6.4 microM ), Bacillus thuringiensis ( MIC = 6.4 microM ), ( MIC = 16 microM ), Staphylococcus carnosus ( MIC = 16 microM ), Listeria monocytogenes (
Hemolytic Activity : Rabbit erythrocytes ( Hemolytic activity at 16 microM )
Validated : Experimentally Validated
Pfam : PF11420 : ( Bacteriocin subtilosin A )
InterPro : IPR021539 : Subtilosin_A.
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM T. Length
CAMPBacH35 HMM 35
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IEA
GO:0019835 Biological Process Cytolysis IEA
GO:0042742 Biological Process Defense response to bacterium IEA
Sequence:
NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG