CAMPSQ3669
Title : Geobacillin I
Source : Geobacillus thermodenitrificans NG80-2
Taxonomy : Bacteria
PubMed : 22431611
Length : 33
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Streptococcus dysgalatiae subsp dysgalactiae ATCC 27957 ( IC50 = 0.69+/- 0.05 microM ), Vancomycin-resistant Enterococcus faecium CNRZ 481 ( IC50 = 0.84+/- 0.05 microM ), Methicillin-resistant Staphylococcus aureus C5 ( IC50 = 2.23+/- 0.03 microM ), Baci
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
VTSKSLCTPGCITGVLMCLTQNSCVSCNSCIRC