CAMPSQ3656
Title : Garvieacin Q
Source : Lactococcus garvieae BCC 43578
Taxonomy : Bacteria
UniProt: H6U5Y1
PubMed : 22210221
Length : 50
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Bacillus coagulans JCM 2257 ( MIC = 0.2048 microM ), Enterococcus faecium D48S52 ( MIC = 3.2775 microM ), Lactobacillus plantarum BCC 9546 ( MIC = 0.0512 microM ), Lactobacillus sakei JCM 1157 ( MIC = 0.0256 microM ), Lactococcus garvieae BCC 7247 ( MIC =
Validated : Experimentally Validated
Comment : Inactive against Enterococcus faecalis JCM 5803, Enterococcus faecium JCM 5804, Escherichia coli ATCC 25922, Lactococcus lactis ATCC 19435, Lactococcus lactis NCDO 497, Listeria ivanovii ATCC 700402, Micrococcus luteus NBRC 12708, Pediococcus acidilactici
Pfam : PF04369 : ( Lactococcin-like family )
AMP Family : Bacteriocin
Sequence:
EYHLMNGANGYLTRVNGKYVYRVTKDPVSAVFGVISNGWGSAGAGFGPQH