CAMPSQ3489
Title : Leucocyclicin Q
GenInfo Identifier : 356640082
Source : Leuconostoc mesenteroides TK41401
Taxonomy : Bacteria
PubMed : 21948835
Length : 61
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Lactococcus lactis subsp. lactis JCM 7638 ( MIC = 0.038 microM ), Lactococcus lactis subsp. lactis ATCC 19435T ( MIC = 0.038 microM ), Lactococcus sp. QU 12 ( MIC = 1.203 microM ), Lactobacillus sakei subsp. sakei JCM 1157T ( MIC = 0.038 microM ), Wei
Validated : Experimentally Validated
Comment : Inactive against Leuconostoc mesenteroides TK41401, Staphylococcus aureus subsp. aureus ATCC 12600T at concentration 38.49 microM
AMP Family : Bacteriocin
Sequence:
LVNQLGISKSLANTILGAIAVGNLASWVLALVPGPGWATKAALATAETIVKHEGKAAAIA
W