CAMPSQ3438
Title : Entianin
GenInfo Identifier : 340561919
Source : Bacillus subtilis DSM 15029T
Taxonomy : Bacteria
UniProt: G0Z2H4
PubMed : 21239550
Length : 32
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Staphylococcus aureus ATCC 29213 ( MIC = 4-8 microg/ml ), Staphylococcus aureus ATCC 43300 (MRSA) ( MIC = 8 microg/ml ), Enterococcus faecalis ATCC 29212 ( MIC = 16 microg/ml ), Enterococcus faecalis ATCC 51299 (VRE) ( MIC = 8-16 microg/ml ), Micrococcus
Validated : Experimentally Validated
Pfam : PF02052 : ( Gallidermin )
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM T. Length
CAMPBacP32 Pattern T-x-[GPTV]-x-[STV]-T-[CGS]-x(3)-[CST]-x(2)-[AL]-[GQ]-[NTV]-x-[GTV]-x(2)-[CS]-x(2)-[PST] 32
CAMPBacH32 HMM 32
Sequence:
WKSESVCTPGCVTGLLQTCFLQTITCNCKISK