CAMPSQ3339
Title : Enterocin X
Source : Enterococcus faecium KU-B5
Taxonomy : Bacteria
PubMed : 20418437
Length : 39
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Enterococcus faecalis JCM 5803 ( MIC = 50.8 nanoM ), Enterococcus faecalis OU510 ( MIC = 102 nanoM ), Enterococcus faecium TUA 1344 ( MIC = 50.8 nanoM ), Enterococcus hirae ATCC 10541 ( MIC = 50.8 nanoM ), Lactobacillus plantarum ATCC 14917 ( MIC = 102 n
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
SNDSLWYGVGQFMGKQANCITNHPVKHMIIPGYCSKILG