CAMPSQ3095
Title : Mutacin IV
Source : Streptococcus mutans UA140
Taxonomy : Bacteria
PubMed : 11133423
Length : 44
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Streptococcus sanguinisstrain NY101, Streptococcus sobrinus OMZ176,Streptococcus sanguinis ATCC 10556,Streptococcus oralis ATCC 10557,Streptococcus gordonii ATCC 10558, Streptococcus mitis ATCC 903,Streptococcus mitis ATCC 33399, Streptococcus parasanguin
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
KVSGGEAVAAIGICATASAAIGGLAGATLVTPYCVGTWGLIRSH