CAMPSQ3092
Title : Thermophilin 13
Source : Streptococcus thermophilus
Taxonomy : Bacteria
PubMed : 9162062
Length : 62
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Streptococcus thermophilus SFi3 ( MIC = 11 nanoM ), Enterococcus faecium SFM1 ( MIC = 413 nanoM ) , Lactococcus cremoris SC11 ( MIC = 413 nanoM ), Lactobacillus acidophilus LQ1 ( MIC = 470 nanoM ), Lactobacillus helveticus LH3 ( MIC = 11 nanoM ), Lactobac
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
YSGKDCLKDMGGYALAGAGSGALWGAPAGGVGALPGAFVGAHVGAIAGGFACMGGMIGNK
FN