CAMPSQ3079
Title : Enterocin 1071
Source : Enterococcus faecalis BFE 1071
Taxonomy : Bacteria
PubMed : 10742203
Length : 39
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Clostridium tyrobutyricum LMG 1285, Enterococcus durans RC1, Enterococcus faecalis LMG 13566, RC2, Enterococcus faecalis FA2-2, Enterococcus faecalis OGX!, Enterococcus faecalis subsp. liquefaciens ATCC 10100, Enterococcus faecium RC3, Lactobacillus sali
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH