CAMPSQ2911
Title : Enterocin A
Source : Enterococcus faecium
Taxonomy : Bacteria
PubMed : 8633865
Length : 47
Activity : Antibacterial
Gram Nature : Gram+ve
Target : Lactobacillus sake NCDO 2714, Pediococcus acidilactici, Listeria innocua , Pediococcus pentosaceus FBB61.1, Lactobacillus plantarum 965, Listeria monocytogenes, Enterococcus faecium, Enterococcus faeclis
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
TTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC