CAMPSQ2894
Title : Enterocin E-760
Source : Enterococcus durans
Taxonomy : Bacteria
PubMed : 18086839
Length : 62
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Salmonella enterica serovar Enteritidis 1 ( MIC = 0.2 microg/ml ), Salmonella enterica serovar Enteritidis 4 ( MIC = 0.4 microg/ml ),Salmonella enterica serovar Enteritidis 204 ( MIC = 0.2 microg/ml ), Salmonella enterica serovar Enteritidis 237 ( MIC = 0
Validated : Experimentally Validated
AMP Family : Bacteriocin
Sequence:
NRWYCNSAAGGVGGAAGCVLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWA
SG