CAMPSQ1100
Title : Propionicin-F
GenInfo Identifier : 75457088
Source : Propionibacterium freudenreichii subsp. freudenreichii
Taxonomy : Bacteria
NCBI Taxonomy : 66712
UniProt: Q6E3K9
PubMed : 15574930
Length : 43
Activity : Antibacterial
Gram Nature : Gram+ve
Target : P. freudenreichii ssp. freudenreichii ATCC 6207T ( MIC = 0.7 nM) , P. freudenreichii ssp. shermanii ATCC 9614T ( MIC = 5.0 nM) , P. freudenreichii ATCC 9616 ( MIC = 20 nM) , P. freudenreichii IFO12426 ( MIC = 2.5 nM) , P. freudenreichii LMGT 2842 ( MIC =
Validated : Experimentally Validated
Comment : Inactive against P.acidipropionici ATCC 4965 ( MIC > 320 nM) , P.acidipropionici ATCC 4875 ( MIC > 320 nM), P.jensenii ATCC 4868T ( MIC > 320 nM) , P.jensenii ATCC 14072 ( MIC > 320 nM) , P.thoenii ATCC 4872 ( MIC > 320 nM) , P.thoenii ATCC 4874 ( MIC > 3
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular Component Extracellular region IDA
GO:0019835 Biological Process Cytolysis IEA
GO:0050830 Biological Process Defense response to Gram-positive bacterium IDA
Sequence:
WFYQGMNIAIYANIGGVANIIGYTEAAVATLLGAVVAVAPVVP