CAMPSQ1010
Title : Brevinin-2TSa
Source : Rana tsushimensis
Taxonomy : Animalia, Amphibians
PubMed : 16413829
Length : 33
Activity : Antibacterial
Gram Nature : Gram+ve, Gram-ve
Target : Escherichia coli ATCC 25922 ( MIC = 3 microM) , Klebsiella pneumoniae KK3 9904 ( MIC = 6 microM) , Enterobacter cloacae HNTCC 53001 ( MIC = 6 microM) , Pseudomonas aeruginosa ATCC 27853 ( MIC = 6 microM) , Proteus mirabilis ATCC 25933 ( MIC > 100 microM)
Hemolytic Activity : Erythrocytes ( LD50 = 100 microM)
Validated : Experimentally Validated
AMP Family : Brevinin
Sequence:
GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC